PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10035456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 248aa    MW: 27316.8 Da    PI: 6.6799
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10035456genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.25.7e-25350249
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 rien+snr vtfskRr g++KKA+ELS+LC+aevav++fs+ ++++ +
  Lus10035456  3 RIENDSNRMVTFSKRRSGVFKKASELSTLCGAEVAVVVFSPGNRVFSF 50
                 8******************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.801154IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-25153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-24268IPR002100Transcription factor, MADS-box
PfamPF003191.5E-26350IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-111631IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-113152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MVRIENDSNR MVTFSKRRSG VFKKASELST LCGAEVAVVV FSPGNRVFSF GNPSVENIMN  60
LFYSGGRFSH HQSDMTAHII EANRKFEIDA LNIKLTQILE NNDKCKKRSE QLDNLLAVNL  120
NRRTIAETPM DELNQAQLFQ YRAGLETLKA GIHIQAQTRA QAFEEAQAYL AQNQPPVQPV  180
FINPAPLPPV TDLLQVAQPQ FAVNPATPGN YEFYQRFGNE NSDSVPAGDG NMMVNGPFGY  240
GHAGPSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-35AGAMOUS-like 62